Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POU2F3 Rabbit Polyclonal Antibody (HRP)

POU2F3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PLA1, OCT11, PLA-1, Epoc-1, OCT-11, OTF-11, Skn-1a

UniProt

Q9UKI9

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human POU2F3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LSVPPVHSTMPGTVTSSCSPGNNSRPSSPGSGLHASSPTASQNNSKAAVN

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_001231611.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-eIF2B epsilon (Ser525) Antibody
MBS9614212-01 0.05 mL

Phospho-eIF2B epsilon (Ser525) Antibody

Sign In for Pricing
View Details
Phospho-eIF2B epsilon (Ser525) Antibody
MBS9614212-02 0.1 mL

Phospho-eIF2B epsilon (Ser525) Antibody

Sign In for Pricing
View Details
Phospho-eIF2B epsilon (Ser525) Antibody
MBS9614212-03 0.2 mL

Phospho-eIF2B epsilon (Ser525) Antibody

Sign In for Pricing
View Details
Phospho-eIF2B epsilon (Ser525) Antibody
MBS9614212-04 5x 0.2 mL

Phospho-eIF2B epsilon (Ser525) Antibody

Sign In for Pricing
View Details
Recombinant Burkholderia phytofirmans Aspartyl/glutamyl-tRNA (Asn/Gln) amidotransferase subunit C
MBS1080058-01 0.02 mg (E-Coli)

Recombinant Burkholderia phytofirmans Aspartyl/glutamyl-tRNA (Asn/Gln) amidotransferase subunit C

Sign In for Pricing
View Details
Recombinant Burkholderia phytofirmans Aspartyl/glutamyl-tRNA (Asn/Gln) amidotransferase subunit C
MBS1080058-02 0.1 mg (E-Coli)

Recombinant Burkholderia phytofirmans Aspartyl/glutamyl-tRNA (Asn/Gln) amidotransferase subunit C

Sign In for Pricing
View Details