Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM58 Rabbit Polyclonal Antibody (Biotin)

TRIM58 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

BIA2

UniProt

Q8NG06

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TRIM58

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FNQLFSGLLRPYFFICDATPLILPPTTIAGSGNWASRDHLDPASDVRDDH

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_056246

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHMP6 Antibody, HRP conjugated
MBS1492759-01 0.05 mg

CHMP6 Antibody, HRP conjugated

Sign In for Pricing
View Details
CHMP6 Antibody, HRP conjugated
MBS1492759-02 0.1 mg

CHMP6 Antibody, HRP conjugated

Sign In for Pricing
View Details
CHMP6 Antibody, HRP conjugated
MBS1492759-03 5x 0.1 mg

CHMP6 Antibody, HRP conjugated

Sign In for Pricing
View Details
TNFRSF10D, ID (TNFRSF10D, DCR2, TRAILR4, TRUNDD, Tumor necrosis factor receptor superfamily member 10D, Decoy receptor 2, TNF-related apoptosis-inducing ligand receptor 4, TRAIL receptor with a truncated death domain, CD264) (APC)
MBS6356912-01 0.2 mL

TNFRSF10D, ID (TNFRSF10D, DCR2, TRAILR4, TRUNDD, Tumor necrosis factor receptor superfamily member 10D, Decoy receptor 2, TNF-related apoptosis-inducing ligand receptor 4, TRAIL receptor with a truncated death domain, CD264) (APC)

Sign In for Pricing
View Details
TNFRSF10D, ID (TNFRSF10D, DCR2, TRAILR4, TRUNDD, Tumor necrosis factor receptor superfamily member 10D, Decoy receptor 2, TNF-related apoptosis-inducing ligand receptor 4, TRAIL receptor with a truncated death domain, CD264) (APC)
MBS6356912-02 5x 0.2 mL

TNFRSF10D, ID (TNFRSF10D, DCR2, TRAILR4, TRUNDD, Tumor necrosis factor receptor superfamily member 10D, Decoy receptor 2, TNF-related apoptosis-inducing ligand receptor 4, TRAIL receptor with a truncated death domain, CD264) (APC)

Sign In for Pricing
View Details
NDE1 (NM_001143979) Human Over-expression Lysate
LS054820-20ug 20 µg

NDE1 (NM_001143979) Human Over-expression Lysate

Sign In for Pricing
View Details