Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Klf15 Rabbit Polyclonal Antibody (HRP)

Klf15 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CKL, KKL, CKLF, KKLF, hlb44, hlb444, AV048136, AW494632, 1810013I09Rik

UniProt

Q9EPW2

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Klf15

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MVDHLLPVDETFSSPKCSVGYLGDRLASRQPYHMLPSPISEDDSDVSSPC

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_075673

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCR4 (CC chemokine receptor type 4, CCCKR4, CCR4, ChemR13, CKR4, CMKBR4, HGCN 14099, K5 5, MGC88293) (MaxLight 550) discontinued
C2099-93M-ML550 100 µL

CCR4 (CC chemokine receptor type 4, CCCKR4, CCR4, ChemR13, CKR4, CMKBR4, HGCN 14099, K5 5, MGC88293) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Rat IL-1 alpha/IL-1F1 ELISA Kit
NR-E10705-01 96 Tests

Rat IL-1 alpha/IL-1F1 ELISA Kit

Sign In for Pricing
View Details
Rat IL-1 alpha/IL-1F1 ELISA Kit
NR-E10705-02 2x 96 Tests

Rat IL-1 alpha/IL-1F1 ELISA Kit

Sign In for Pricing
View Details
Rat IL-1 alpha/IL-1F1 ELISA Kit
NR-E10705-03 4x 96 Tests

Rat IL-1 alpha/IL-1F1 ELISA Kit

Sign In for Pricing
View Details
MKRN1 Peptide
orb2016503 100 µg

MKRN1 Peptide

Sign In for Pricing
View Details
Recombinant Human PPM1A Protein
MBS8249628-01 0.01 mg

Recombinant Human PPM1A Protein

Sign In for Pricing
View Details