Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gtf2b Rabbit Polyclonal Antibody (Biotin)

Gtf2b Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

P62916

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GAASFDEFGNSKYQNRRTMSSSDRAMMNAFKEITTMADRINLPRNIVDRT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_112303

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trim44 Peptide - C-terminal region
orb2008605 100 µg

Trim44 Peptide - C-terminal region

Sign In for Pricing
View Details
Anticonvulsant agent 1
HY-U00348 1 Each

Anticonvulsant agent 1

Sign In for Pricing
View Details
IL12B Human Over-expression Lysate
orb1378712 20 µg

IL12B Human Over-expression Lysate

Sign In for Pricing
View Details
Lentiviral mouse Polr2b shRNA (UAS) - Lentiviral mousePolr2b shRNA (UAS, GFP) (25)
GTR15221480 1 Vial

Lentiviral mouse Polr2b shRNA (UAS) - Lentiviral mousePolr2b shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
HAAO (3-hydroxyanthranilate 3,4-dioxygenase, 3-hydroxyanthranilate Oxygenase, 3-HAO, 3-hydroxyanthranilic Acid Dioxygenase, HAD) (MaxLight 750)
MBS6233174-01 0.1 mL

HAAO (3-hydroxyanthranilate 3,4-dioxygenase, 3-hydroxyanthranilate Oxygenase, 3-HAO, 3-hydroxyanthranilic Acid Dioxygenase, HAD) (MaxLight 750)

Sign In for Pricing
View Details
HAAO (3-hydroxyanthranilate 3,4-dioxygenase, 3-hydroxyanthranilate Oxygenase, 3-HAO, 3-hydroxyanthranilic Acid Dioxygenase, HAD) (MaxLight 750)
MBS6233174-02 5x 0.1 mL

HAAO (3-hydroxyanthranilate 3,4-dioxygenase, 3-hydroxyanthranilate Oxygenase, 3-HAO, 3-hydroxyanthranilic Acid Dioxygenase, HAD) (MaxLight 750)

Sign In for Pricing
View Details