Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZBTB48 Rabbit Polyclonal Antibody (HRP)

ZBTB48 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HKR3, TZAP, ZNF855, pp9964

UniProt

P10074

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZBTB48

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EFCSHAFTQKANLNMHLRTHTGEKPFQCHLCGKTFRTQASLDKHNRTHTG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

77kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005332

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal KRR1 Antibody
NBP1-92060 0.1 mL

Rabbit Polyclonal KRR1 Antibody

Sign In for Pricing
View Details
Reusable Goniometer Base B3
GB-B3-R-10 10 PCS

Reusable Goniometer Base B3

Sign In for Pricing
View Details
TRDN Antibody, FITC conjugated
CSB-PA024398LC01HU-01 50 µg

TRDN Antibody, FITC conjugated

Sign In for Pricing
View Details
TRDN Antibody, FITC conjugated
CSB-PA024398LC01HU-02 100 µg

TRDN Antibody, FITC conjugated

Sign In for Pricing
View Details
Recombinant Clostridium Difficile ispH Protein (aa 1-279)
VAng-Lsx9213-50gEcoli 50 µg (E. coli)

Recombinant Clostridium Difficile ispH Protein (aa 1-279)

Sign In for Pricing
View Details
ACTL6A Rabbit mAb
E45R12258N-50 50 µL

ACTL6A Rabbit mAb

Sign In for Pricing
View Details