Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HLX Rabbit Polyclonal Antibody (FITC)

HLX Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HB24, HLX1

UniProt

Q14774

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human HLX

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: WFQNRRMKWRHSKEAQAQKDKDKEAGEKPSGGAPAADGEQDERSPSRSEG

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_068777

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Slc30a1 shRNA (UAS) - Lentiviral mouse Slc30a1 shRNA (UAS, iRFP) (100)
GTR15200115 1 Vial

Lentiviral mouse Slc30a1 shRNA (UAS) - Lentiviral mouse Slc30a1 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
ATP1A1 Antibody, HRP conjugated
A46992-100UG 100 µg

ATP1A1 Antibody, HRP conjugated

Sign In for Pricing
View Details
RBP3 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
38706154 3x 1.0 µg DNA

RBP3 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
HAVCR1, NT (HAVCR1, KIM1, TIM1, TIMD1, Hepatitis A virus cellular receptor 1, Kidney injury molecule 1, T-cell immunoglobulin and mucin domain-containing protein 1, T-cell membrane protein 1, TIM-1) (MaxLight 650)
MBS6305545-01 0.1 mL

HAVCR1, NT (HAVCR1, KIM1, TIM1, TIMD1, Hepatitis A virus cellular receptor 1, Kidney injury molecule 1, T-cell immunoglobulin and mucin domain-containing protein 1, T-cell membrane protein 1, TIM-1) (MaxLight 650)

Sign In for Pricing
View Details
HAVCR1, NT (HAVCR1, KIM1, TIM1, TIMD1, Hepatitis A virus cellular receptor 1, Kidney injury molecule 1, T-cell immunoglobulin and mucin domain-containing protein 1, T-cell membrane protein 1, TIM-1) (MaxLight 650)
MBS6305545-02 5x 0.1 mL

HAVCR1, NT (HAVCR1, KIM1, TIM1, TIMD1, Hepatitis A virus cellular receptor 1, Kidney injury molecule 1, T-cell immunoglobulin and mucin domain-containing protein 1, T-cell membrane protein 1, TIM-1) (MaxLight 650)

Sign In for Pricing
View Details
NNMT Activity Assay Kit (Colorimetric / Fluorometric)
TBS2098-100 100 Tests

NNMT Activity Assay Kit (Colorimetric / Fluorometric)

Sign In for Pricing
View Details