Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HLX Rabbit Polyclonal Antibody (HRP)

HLX Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HB24, HLX1

UniProt

Q14774

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human HLX

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: WFQNRRMKWRHSKEAQAQKDKDKEAGEKPSGGAPAADGEQDERSPSRSEG

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_068777

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-MAK (Tyr159) Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2478147 100 µL

Phospho-MAK (Tyr159) Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
4-Hydroxy Atorvastatin-d5 Disodium
CS-O-02780 1 Each

4-Hydroxy Atorvastatin-d5 Disodium

Sign In for Pricing
View Details
Lentiviral mouse Lrrtm1 shRNA (UAS) - Lentiviral mouseLrrtm1 shRNA (UAS, GFP) (25)
GTR15232004 1 Vial

Lentiviral mouse Lrrtm1 shRNA (UAS) - Lentiviral mouseLrrtm1 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Anti-Mouse CD3E Antibody (500A2), FITC
ARO-A10805-01 50 µg

Anti-Mouse CD3E Antibody (500A2), FITC

Sign In for Pricing
View Details
Anti-Mouse CD3E Antibody (500A2), FITC
ARO-A10805-02 100 µg

Anti-Mouse CD3E Antibody (500A2), FITC

Sign In for Pricing
View Details
Anti-Mouse CD3E Antibody (500A2), FITC
ARO-A10805-03 1 mg

Anti-Mouse CD3E Antibody (500A2), FITC

Sign In for Pricing
View Details