Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXB3 Rabbit Polyclonal Antibody (Biotin)

HOXB3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HOX2, HOX2G, Hox-2.7

UniProt

P14651

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human HOXB3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SGNLDYNGAPPMAPSQHHGPCEPHPTYTDLSSHHAPPPQGRIQEAPKLTH

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_002137

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

HDAC1 Antibody : FITC (OAAF01824-FITC)
OAAF01824-100UG-FITC 100 µg

HDAC1 Antibody : FITC (OAAF01824-FITC)

Sign In for Pricing
View Details
Hist2h2ab sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
23386114 3x 1.0 µg

Hist2h2ab sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Human Monoclonal ErbB2/Her2 Antibody (margetuximab) [Janelia Fluor 585]
NBP3-28150JF585 0.1 mL

Human Monoclonal ErbB2/Her2 Antibody (margetuximab) [Janelia Fluor 585]

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Ethylene-responsive transcription factor 3 (ERF3)
MBS1161068-01 0.02 mg (E-Coli)

Recombinant Arabidopsis thaliana Ethylene-responsive transcription factor 3 (ERF3)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Ethylene-responsive transcription factor 3 (ERF3)
MBS1161068-02 0.1 mg (E-Coli)

Recombinant Arabidopsis thaliana Ethylene-responsive transcription factor 3 (ERF3)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Ethylene-responsive transcription factor 3 (ERF3)
MBS1161068-03 0.02 mg (Yeast)

Recombinant Arabidopsis thaliana Ethylene-responsive transcription factor 3 (ERF3)

Sign In for Pricing
View Details