Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pou3f1 Rabbit Polyclonal Antibody (Biotin)

Pou3f1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

S, Oct, Otf, Tst, Oct-, Oct6, Otf6, Scip, Tst-, Tst1, Oct-6, Otf-6, Test1, Tst-1

UniProt

P21952

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QYLPRGPGGGAGGTGPLMHPDAAAAAAAAAERLHAGAAYREVQKLMHHEW

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_035271

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/3126R), CF740 conjugate, 0.1mg/mL
BNC743126-100 1x 100 µL

CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/3126R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (M3A7), 0.2mg/mL
BNUB1827-500 1x 500 µL

CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (M3A7), 0.2mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2818R), CF405S conjugate, 0.1mg/mL
BNC042818-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2818R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Elab Fluor® Violet 500 Mouse IgM, κ Isotype Control[MM-30]
E-AB-F09783R-01 25 µg

Elab Fluor® Violet 500 Mouse IgM, κ Isotype Control[MM-30]

Sign In for Pricing
View Details
Elab Fluor® Violet 500 Mouse IgM, κ Isotype Control[MM-30]
E-AB-F09783R-02 100 µg

Elab Fluor® Violet 500 Mouse IgM, κ Isotype Control[MM-30]

Sign In for Pricing
View Details
Bcl-2 (100/D5), CF640R conjugate, 0.1mg/mL
BNC400045-500 1x 500 µL

Bcl-2 (100/D5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details