Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pou3f1 Rabbit Polyclonal Antibody (HRP)

Pou3f1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

S, Oct, Otf, Tst, Oct-, Oct6, Otf6, Scip, Tst-, Tst1, Oct-6, Otf-6, Test1, Tst-1

UniProt

P21952

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QYLPRGPGGGAGGTGPLMHPDAAAAAAAAAERLHAGAAYREVQKLMHHEW

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_035271

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytochrome C Recombinant Rabbit mAb, AP conjugated
orb3125258 100 µL

Cytochrome C Recombinant Rabbit mAb, AP conjugated

Sign In for Pricing
View Details
Lentiviral mouse Defa42 shRNA (UAS) - Lentiviral mouse Defa42 shRNA (UAS) plasmid
GTR15199075 1 Vial

Lentiviral mouse Defa42 shRNA (UAS) - Lentiviral mouse Defa42 shRNA (UAS) plasmid

Sign In for Pricing
View Details
UNC5C (Protein Unc-5 Homolog C, Netrin Receptor UNC5C, Protein Unc-5 Homolog 3, UNC5H3) (FITC)
135107-FITC 100 µL

UNC5C (Protein Unc-5 Homolog C, Netrin Receptor UNC5C, Protein Unc-5 Homolog 3, UNC5H3) (FITC)

Sign In for Pricing
View Details
RASA2 Rabbit Polyclonal Antibody
orb3072111-01 30 µL

RASA2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RASA2 Rabbit Polyclonal Antibody
orb3072111-02 50 µL

RASA2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RASA2 Rabbit Polyclonal Antibody
orb3072111-03 100 µL

RASA2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details