Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF334 Rabbit Polyclonal Antibody (Biotin)

ZNF334 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q9HCZ1

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF334

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KMKKFQIPVSFQDLTVNFTQEEWQQLDPAQRLLYRDVMLENYSNLVSVGY

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

80kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_060572

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Human BCL2 pAb
PA4276-01 50 μL

Rabbit Anti-Human BCL2 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human BCL2 pAb
PA4276-02 100 μL

Rabbit Anti-Human BCL2 pAb

Sign In for Pricing
View Details
KIR2DS3, CT (KIR2DS3, NKAT7, Killer cell immunoglobulin-like receptor 2DS3, MHC class I NK cell receptor, Natural killer-associated transcript 7) (MaxLight 750)
MBS6313422-01 0.1 mL

KIR2DS3, CT (KIR2DS3, NKAT7, Killer cell immunoglobulin-like receptor 2DS3, MHC class I NK cell receptor, Natural killer-associated transcript 7) (MaxLight 750)

Sign In for Pricing
View Details
KIR2DS3, CT (KIR2DS3, NKAT7, Killer cell immunoglobulin-like receptor 2DS3, MHC class I NK cell receptor, Natural killer-associated transcript 7) (MaxLight 750)
MBS6313422-02 5x 0.1 mL

KIR2DS3, CT (KIR2DS3, NKAT7, Killer cell immunoglobulin-like receptor 2DS3, MHC class I NK cell receptor, Natural killer-associated transcript 7) (MaxLight 750)

Sign In for Pricing
View Details
KLHDC8A (NM_001271864) Human Tagged ORF Clone
RC232552 10 µg

KLHDC8A (NM_001271864) Human Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Phenylobacterium zucineum Succinyl-diaminopimelate desuccinylase (dapE)
MBS1188854-01 0.02 mg (E-Coli)

Recombinant Phenylobacterium zucineum Succinyl-diaminopimelate desuccinylase (dapE)

Sign In for Pricing
View Details