Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMD4 Rabbit Polyclonal Antibody (HRP)

PSMD4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AF, ASF, S5A, AF-1, MCB1, Rpn10, pUB-R5

UniProt

P55036

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PSMD4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VLESTMVCVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVGL

Field of Research

Cancer Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002801

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MYPT1, Phosphorylated (Thr853/Thr850) (Myosin Phosphatase 1) (MaxLight 550)
MBS6489203-01 0.1 mL

MYPT1, Phosphorylated (Thr853/Thr850) (Myosin Phosphatase 1) (MaxLight 550)

Sign In for Pricing
View Details
MYPT1, Phosphorylated (Thr853/Thr850) (Myosin Phosphatase 1) (MaxLight 550)
MBS6489203-02 5x 0.1 mL

MYPT1, Phosphorylated (Thr853/Thr850) (Myosin Phosphatase 1) (MaxLight 550)

Sign In for Pricing
View Details
Tars2 ORF Vector (Rat) (pORF)
46132016 1.0 µg DNA

Tars2 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
EGR2 Polyclonal Antibody
E915053 100 µL

EGR2 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti Human KLK11 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (IHC,ELISA) 120ul
IRBAHUKLK11AP357120UL 120 µL

Rabbit Anti Human KLK11 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (IHC,ELISA) 120ul

Sign In for Pricing
View Details
Zfp516 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
51007116 3x 1.0 µg

Zfp516 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details