Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMD4 Rabbit Polyclonal Antibody (HRP)

PSMD4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AF, ASF, S5A, AF-1, MCB1, Rpn10, pUB-R5

UniProt

P55036

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PSMD4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VLESTMVCVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVGL

Field of Research

Cancer Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002801

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cdh20 Rabbit Polyclonal Antibody
orb580951 100 µL

Cdh20 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Conjugated Prealbumin Rabbit mAb
C59292 100 µL

Conjugated Prealbumin Rabbit mAb

Sign In for Pricing
View Details
NUBP1 Protein Vector (Rat) (pPM-C-HA)
PV286320 500 ng

NUBP1 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Glutamine synthetase Rabbit Polyclonal Antibody (Cy3)
orb989371 100 µL

Glutamine synthetase Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
MYO1B siRNA (Rat)
MBS8230640-01 15 nmol

MYO1B siRNA (Rat)

Sign In for Pricing
View Details
MYO1B siRNA (Rat)
MBS8230640-02 30 nmol

MYO1B siRNA (Rat)

Sign In for Pricing
View Details