Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Skil Rabbit Polyclonal Antibody (Biotin)

Skil Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

S, sno, Skir, SnoN, sno-

UniProt

Q3TB81

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EQVMQQKCTCDSTLEKDREAEYAAQLAELRQRLDHAEADRQELQDELRQE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

71kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001034179

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BrdU Immunohistochemistry Kit
MBS574011-01 50 Slides

BrdU Immunohistochemistry Kit

Sign In for Pricing
View Details
BrdU Immunohistochemistry Kit
MBS574011-02 5x 50 Slides

BrdU Immunohistochemistry Kit

Sign In for Pricing
View Details
MARCH5 (RNF153, E3 Ubiquitin-protein Ligase MARCH5, Membrane-associated RING Finger Protein 5, Membrane-associated RING-CH Protein V, Mitochondrial Ubiquitin Ligase, RING Finger Protein 153, FLJ20445, MARCH-V) (MaxLight 650)
MBS6223113-01 0.1 mL

MARCH5 (RNF153, E3 Ubiquitin-protein Ligase MARCH5, Membrane-associated RING Finger Protein 5, Membrane-associated RING-CH Protein V, Mitochondrial Ubiquitin Ligase, RING Finger Protein 153, FLJ20445, MARCH-V) (MaxLight 650)

Sign In for Pricing
View Details
MARCH5 (RNF153, E3 Ubiquitin-protein Ligase MARCH5, Membrane-associated RING Finger Protein 5, Membrane-associated RING-CH Protein V, Mitochondrial Ubiquitin Ligase, RING Finger Protein 153, FLJ20445, MARCH-V) (MaxLight 650)
MBS6223113-02 5x 0.1 mL

MARCH5 (RNF153, E3 Ubiquitin-protein Ligase MARCH5, Membrane-associated RING Finger Protein 5, Membrane-associated RING-CH Protein V, Mitochondrial Ubiquitin Ligase, RING Finger Protein 153, FLJ20445, MARCH-V) (MaxLight 650)

Sign In for Pricing
View Details
Dnaaf2 Recombinant Protein (Rat)
RP198260 100 µg

Dnaaf2 Recombinant Protein (Rat)

Sign In for Pricing
View Details
Atibuclimab
T77484-01 1 mg

Atibuclimab

Sign In for Pricing
View Details