Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Skil Rabbit Polyclonal Antibody (Biotin)

Skil Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

S, sno, Skir, SnoN, sno-

UniProt

Q3TB81

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EQVMQQKCTCDSTLEKDREAEYAAQLAELRQRLDHAEADRQELQDELRQE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

71kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001034179

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDIA5 (Protein Disulfide-isomerase A5, Protein Disulfide Isomerase-related Protein, PDIR) (MaxLight 490)
131084-ML490 100 µL

PDIA5 (Protein Disulfide-isomerase A5, Protein Disulfide Isomerase-related Protein, PDIR) (MaxLight 490)

Sign In for Pricing
View Details
Theobromine
C08498-50mg 50 mg

Theobromine

Sign In for Pricing
View Details
MS4A1, CT (MS4A1, CD20, B-lymphocyte antigen CD20, B-lymphocyte surface antigen B1, Bp35, Leukocyte surface antigen Leu-16, Membrane-spanning 4-domains subfamily A member 1, CD20) (APC)
MBS6322374-01 0.2 mL

MS4A1, CT (MS4A1, CD20, B-lymphocyte antigen CD20, B-lymphocyte surface antigen B1, Bp35, Leukocyte surface antigen Leu-16, Membrane-spanning 4-domains subfamily A member 1, CD20) (APC)

Sign In for Pricing
View Details
MS4A1, CT (MS4A1, CD20, B-lymphocyte antigen CD20, B-lymphocyte surface antigen B1, Bp35, Leukocyte surface antigen Leu-16, Membrane-spanning 4-domains subfamily A member 1, CD20) (APC)
MBS6322374-02 5x 0.2 mL

MS4A1, CT (MS4A1, CD20, B-lymphocyte antigen CD20, B-lymphocyte surface antigen B1, Bp35, Leukocyte surface antigen Leu-16, Membrane-spanning 4-domains subfamily A member 1, CD20) (APC)

Sign In for Pricing
View Details
NM23A Antibody
orb1318824 100 µL

NM23A Antibody

Sign In for Pricing
View Details
Anti-Hsp60/HSPD1 Antibody Picoband® (monoclonal, 6G2), HRP Conjugate
M01280-3-HRP 100 µg/Vial

Anti-Hsp60/HSPD1 Antibody Picoband® (monoclonal, 6G2), HRP Conjugate

Sign In for Pricing
View Details