Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SKIL Rabbit Polyclonal Antibody (FITC)

SKIL Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SNO, SnoA, SnoI, SnoN

UniProt

P12757

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SKIL

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LQNEHAQRMEEFYVEQKDLEKKLEQIMKQKCTCDSNLEKDKEAEYAGQLA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

70kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001138569

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCARA5 Rabbit Polyclonal Antibody (Cy3)
orb2581331 100 µg

SCARA5 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Smarcc1 (SWI/SNF Complex Subunit SMARCC1, BRG1-Associated Factor 155, SWI/SNF Complex 155kD Subunit, SWI/SNF-Related Matrix-Associated Actin-Dependent Regulator of Chromatin Subfamily C Member 1, SWI3-Related Protein, BAF155, Smarcc1, Baf155, Srg3) (MaxLight 405) discontinued
302755-ML405 100 µL

Smarcc1 (SWI/SNF Complex Subunit SMARCC1, BRG1-Associated Factor 155, SWI/SNF Complex 155kD Subunit, SWI/SNF-Related Matrix-Associated Actin-Dependent Regulator of Chromatin Subfamily C Member 1, SWI3-Related Protein, BAF155, Smarcc1, Baf155, Srg3) (MaxLight 405) discontinued

Sign In for Pricing
View Details
FAAH (Fatty Acid Amide Hydrolase, FAAH-1, MGC102823, MGC138146) (MaxLight 405)
MBS6195423-01 0.1 mL

FAAH (Fatty Acid Amide Hydrolase, FAAH-1, MGC102823, MGC138146) (MaxLight 405)

Sign In for Pricing
View Details
FAAH (Fatty Acid Amide Hydrolase, FAAH-1, MGC102823, MGC138146) (MaxLight 405)
MBS6195423-02 5x 0.1 mL

FAAH (Fatty Acid Amide Hydrolase, FAAH-1, MGC102823, MGC138146) (MaxLight 405)

Sign In for Pricing
View Details
2-Methylcyclopentanamine hydrochloride
FAA45476-01 100 mg

2-Methylcyclopentanamine hydrochloride

Sign In for Pricing
View Details
2-Methylcyclopentanamine hydrochloride
FAA45476-02 1 g

2-Methylcyclopentanamine hydrochloride

Sign In for Pricing
View Details