Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SKIL Rabbit Polyclonal Antibody (HRP)

SKIL Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SNO, SnoA, SnoI, SnoN

UniProt

P12757

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SKIL

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LQNEHAQRMEEFYVEQKDLEKKLEQIMKQKCTCDSNLEKDKEAEYAGQLA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

70kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001138569

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal Anti-β-hCG Antibody
TBS10123-1MG 1 mg

Monoclonal Anti-β-hCG Antibody

Sign In for Pricing
View Details
Biotin (Vitamin B7, Vitamin H) (BSA & Azide Free) (MaxLight 490)
168650-AF-ML490 100 µL

Biotin (Vitamin B7, Vitamin H) (BSA & Azide Free) (MaxLight 490)

Sign In for Pricing
View Details
TONSL Antibody (Biotin)
orb53626-01 50 µg

TONSL Antibody (Biotin)

Sign In for Pricing
View Details
TONSL Antibody (Biotin)
orb53626-02 100 µg

TONSL Antibody (Biotin)

Sign In for Pricing
View Details
KLHL2 (Kelch-like Protein 2, Actin-binding Protein Mayven, ABP-KELCH) (MaxLight 650)
128869-ML650 100 µL

KLHL2 (Kelch-like Protein 2, Actin-binding Protein Mayven, ABP-KELCH) (MaxLight 650)

Sign In for Pricing
View Details
Mammal IL-4 ELISA Kit
orb1216625-01 1 set (1 x capture antibody)

Mammal IL-4 ELISA Kit

Sign In for Pricing
View Details