Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Vascular endothelial growth factor B (VEGFB), partial

Product Specifications

Product Name Alternative

VEGF-related factor ; VRF

Abbreviation

Recombinant Human VEGFB protein, partial

Gene Name

VEGFB

UniProt

P49765

Expression Region

31-129aa

Organism

Homo sapiens (Human)

Target Sequence

HQRKVVSWIDVYTRATCQPREVVVPLTVELMGTVAKQLVPSCVTVQRCGGCCPDDGLECVPTGQHQVRMQILMIRYPSSQLGEMSLEEHSQCECRPKKK

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cancer

Relevance

Growth factor for endothelial cells. VEGF-B167 binds heparin and neuropilin-1 whereas the binding to neuropilin-1 of VEGF-B186 is regulated by proteolysis.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

24.1 kDa

References & Citations

Cloning and characterization of a novel human gene related to vascular endothelial growth factor.Grimmond S., Lagercrantz J., Drinkwater C., Silins G., Townson S., Pollock P., Gotley D., Carson E., Rakar S., Nordenskjoeld M., Ward L., Hayward N.K., Weber G.Genome Res. 6:124-131 (1996)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsp75 (TRAP1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A1]
TA504224BM 100 µL

Hsp75 (TRAP1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A1]

Sign In for Pricing
View Details
MYT1L Antibody
KC-3586-01 50 μL

MYT1L Antibody

Sign In for Pricing
View Details
MYT1L Antibody
KC-3586-02 100 µL

MYT1L Antibody

Sign In for Pricing
View Details
MYT1L Antibody
KC-3586-03 1 mL

MYT1L Antibody

Sign In for Pricing
View Details
c Fos (FOS) pThr232 Rabbit Polyclonal Antibody
AP12766PU-N 400 µL

c Fos (FOS) pThr232 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2-Hydroxycaprylic Acid
TRC-H999988-50MG 50 mg

2-Hydroxycaprylic Acid

Sign In for Pricing
View Details