Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GCFC2 Rabbit Polyclonal Antibody (Biotin)

GCFC2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

GCF, TCF9, DNABF, C2orf3

UniProt

P16383

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human GCFC2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MKRESEDDPESEPDDHEKRIPFTLRPQTLRQRMAEESISRNEETSEESQE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

85kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_003194

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTNND1 (NM_001085469) Human Untagged Clone
SC316267 10 µg

CTNND1 (NM_001085469) Human Untagged Clone

Sign In for Pricing
View Details
TARSL2 sgRNA CRISPR Lentivector set (Human)
K2332901 3x 1.0 µg

TARSL2 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Lentiviral human FZD6 shRNA (UAS) - Lentiviral human FZD6 shRNA (UAS, RFP) plasmid
GTR15347104 1 Vial

Lentiviral human FZD6 shRNA (UAS) - Lentiviral human FZD6 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Human Platelet-derived growth factor C ELISA Kit
MBS9425729-01 96 Tests

Human Platelet-derived growth factor C ELISA Kit

Sign In for Pricing
View Details
Human Platelet-derived growth factor C ELISA Kit
MBS9425729-02 5x 96 Tests

Human Platelet-derived growth factor C ELISA Kit

Sign In for Pricing
View Details
Mouse Lipid phosphate phosphatase-related protein type 1 ELISA Kit
MBS288477-01 48 Well

Mouse Lipid phosphate phosphatase-related protein type 1 ELISA Kit

Sign In for Pricing
View Details