Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C2orf3 Rabbit Polyclonal Antibody (HRP)

C2orf3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GCF, TCF9, DNABF, C2orf3

UniProt

P16383

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human C2orf3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SEPDDHEKRIPFTLRPQTLRQRMAEESISRNEETSEESQEDEKQDTWEQQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

89kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_003194

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CEP135 Antibody
8C15038-AAT 50 µg

CEP135 Antibody

Sign In for Pricing
View Details
Alkaline Phosphatase (Placental) / PLAP (Germ Cell Tumor Marker) (ALPP/2899R), CF568 conjugate, 0.1mg/mL
BNC682899-500 1x 500 µL

Alkaline Phosphatase (Placental) / PLAP (Germ Cell Tumor Marker) (ALPP/2899R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Glypican-3 (GPC3) (Hepatocellular Carcinoma Marker), CF568 conjugate, 0.1mg/mL
BNC681645-500 1x 500 µL

Glypican-3 (GPC3) (Hepatocellular Carcinoma Marker), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Spectrin Alpha 1 (Erythrocyte Marker) (rSPTA1/1833), 0.2mg/mL
BNUB2556-500 1x 500 µL

Spectrin Alpha 1 (Erythrocyte Marker) (rSPTA1/1833), 0.2mg/mL

Sign In for Pricing
View Details
HER-2 / c-erbB-2 / neu / CD340 (ERBB2/2452), CF488A conjugate, 0.1mg/mL
BNC882452-500 1x 500 µL

HER-2 / c-erbB-2 / neu / CD340 (ERBB2/2452), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IGFBP-4 Antibody Pair Set
E-KAB-0179 50 µL & 100 µg

Human IGFBP-4 Antibody Pair Set

Sign In for Pricing
View Details