Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VTN Rabbit Polyclonal Antibody (Biotin)

VTN Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

VN, V75, VNT

UniProt

P04004

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human VTN

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_000629

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-West Nile Virus (WNV) (lineage 1, strain NY99) E/Envelope (Domain III) Antibody (8K74)
TMAY-02912-01 20 µL

Anti-West Nile Virus (WNV) (lineage 1, strain NY99) E/Envelope (Domain III) Antibody (8K74)

Sign In for Pricing
View Details
Anti-West Nile Virus (WNV) (lineage 1, strain NY99) E/Envelope (Domain III) Antibody (8K74)
TMAY-02912-02 100 µL

Anti-West Nile Virus (WNV) (lineage 1, strain NY99) E/Envelope (Domain III) Antibody (8K74)

Sign In for Pricing
View Details
Phospho-NFKB1 (Ser893) Rabbit pAb
E47R5513 100 µL

Phospho-NFKB1 (Ser893) Rabbit pAb

Sign In for Pricing
View Details
UBAP1, NT (Nasopharyngeal carcinoma-associated gene 20 protein, UAP, UBAP, UBAP-1, Ubiquitin-associated protein 1) (MaxLight 550) discontinued
U0845-49-ML550 100 µL

UBAP1, NT (Nasopharyngeal carcinoma-associated gene 20 protein, UAP, UBAP, UBAP-1, Ubiquitin-associated protein 1) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Human Coiled coil helix coiled coil helix domain containing protein 7 (CHCHD7) ELISA Kit
MBS7218988-01 48 Well

Human Coiled coil helix coiled coil helix domain containing protein 7 (CHCHD7) ELISA Kit

Sign In for Pricing
View Details
Human Coiled coil helix coiled coil helix domain containing protein 7 (CHCHD7) ELISA Kit
MBS7218988-02 96 Well

Human Coiled coil helix coiled coil helix domain containing protein 7 (CHCHD7) ELISA Kit

Sign In for Pricing
View Details