Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WNT8B Rabbit Polyclonal Antibody (Biotin)

WNT8B Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q93098

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human WNT8B

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNG

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003384

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAD23 Homolog A, Nucleotide Excision Repair Protein (RAD23A) Antibody
abx146995 100 µg

RAD23 Homolog A, Nucleotide Excision Repair Protein (RAD23A) Antibody

Sign In for Pricing
View Details
M-phase inducer phosphatase 1 (CDC25A)(MBP-his tagged)-100
AR09-P0030-100 100ug

M-phase inducer phosphatase 1 (CDC25A)(MBP-his tagged)-100

Sign In for Pricing
View Details
Monkey Aquaporin 4 (AQP4) ELISA Kit
abx359171 96 Well

Monkey Aquaporin 4 (AQP4) ELISA Kit

Sign In for Pricing
View Details
7,7-dimethyl-1- ((((4- (isopropyl) phenyl) amino) sulfonyl) methyl) bicyclo[2.2.1]heptan-2-one
CAB84463 250 mg

7,7-dimethyl-1- ((((4- (isopropyl) phenyl) amino) sulfonyl) methyl) bicyclo[2.2.1]heptan-2-one

Sign In for Pricing
View Details
Rabbit Polyclonal PFDN2 Antibody
NBP2-58113-25ul 25 µL

Rabbit Polyclonal PFDN2 Antibody

Sign In for Pricing
View Details
CDC42EP1 (Cdc42 Effector Protein 1, Binder of Rho GTPases 5, Serum Protein MSE55, BORG5, CEP1, MSE55) (AP)
MBS6130501-01 0.1 mL

CDC42EP1 (Cdc42 Effector Protein 1, Binder of Rho GTPases 5, Serum Protein MSE55, BORG5, CEP1, MSE55) (AP)

Sign In for Pricing
View Details