Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WNT8B Rabbit Polyclonal Antibody (FITC)

WNT8B Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q93098

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human WNT8B

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNG

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003384

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Myl12b shRNA (UAS) - Lentiviral mouse Myl12b shRNA (UAS, iRFP) plasmid
GTR15170440 1 Vial

Lentiviral mouse Myl12b shRNA (UAS) - Lentiviral mouse Myl12b shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
MAP3K2 Rabbit Polyclonal Antibody
orb580679 100 µL

MAP3K2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human MAP kinase-activating death domain protein, MADD ELISA Kit
MBS1606535-01 48 Well

Human MAP kinase-activating death domain protein, MADD ELISA Kit

Sign In for Pricing
View Details
Human MAP kinase-activating death domain protein, MADD ELISA Kit
MBS1606535-02 96 Well

Human MAP kinase-activating death domain protein, MADD ELISA Kit

Sign In for Pricing
View Details
Human MAP kinase-activating death domain protein, MADD ELISA Kit
MBS1606535-03 5x 96 Well

Human MAP kinase-activating death domain protein, MADD ELISA Kit

Sign In for Pricing
View Details
Human MAP kinase-activating death domain protein, MADD ELISA Kit
MBS1606535-04 10x 96 Well

Human MAP kinase-activating death domain protein, MADD ELISA Kit

Sign In for Pricing
View Details