Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wnt8b Rabbit Polyclonal Antibody (Biotin)

Wnt8b Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q9WUD6

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Wnt8b

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRR

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_035850

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIC 263-F-A2-B7527 AC Signs
808056 Card of 1 Pictogram(s)

PIC 263-F-A2-B7527 AC Signs

Sign In for Pricing
View Details
Dog B-Cell CLL/Lymphoma 2 Like Protein 2 (Bcl2L2) Protein
abx065508-01 50 µg

Dog B-Cell CLL/Lymphoma 2 Like Protein 2 (Bcl2L2) Protein

Sign In for Pricing
View Details
Dog B-Cell CLL/Lymphoma 2 Like Protein 2 (Bcl2L2) Protein
abx065508-02 100 µg

Dog B-Cell CLL/Lymphoma 2 Like Protein 2 (Bcl2L2) Protein

Sign In for Pricing
View Details
Dog B-Cell CLL/Lymphoma 2 Like Protein 2 (Bcl2L2) Protein
abx065508-03 200 µg

Dog B-Cell CLL/Lymphoma 2 Like Protein 2 (Bcl2L2) Protein

Sign In for Pricing
View Details
Dog B-Cell CLL/Lymphoma 2 Like Protein 2 (Bcl2L2) Protein
abx065508-04 500 µg

Dog B-Cell CLL/Lymphoma 2 Like Protein 2 (Bcl2L2) Protein

Sign In for Pricing
View Details
Dog B-Cell CLL/Lymphoma 2 Like Protein 2 (Bcl2L2) Protein
abx065508-05 1 mg

Dog B-Cell CLL/Lymphoma 2 Like Protein 2 (Bcl2L2) Protein

Sign In for Pricing
View Details