Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wnt8b Rabbit Polyclonal Antibody (HRP)

Wnt8b Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q9WUD6

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Wnt8b

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRR

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_035850

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PI3KCD, CT (PIK3CD, Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform, Phosphatidylinositol 4,5-bisphosphate 3-kinase 110kD catalytic subunit delta) (FITC)
MBS6333676-01 0.2 mL

PI3KCD, CT (PIK3CD, Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform, Phosphatidylinositol 4,5-bisphosphate 3-kinase 110kD catalytic subunit delta) (FITC)

Sign In for Pricing
View Details
PI3KCD, CT (PIK3CD, Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform, Phosphatidylinositol 4,5-bisphosphate 3-kinase 110kD catalytic subunit delta) (FITC)
MBS6333676-02 5x 0.2 mL

PI3KCD, CT (PIK3CD, Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform, Phosphatidylinositol 4,5-bisphosphate 3-kinase 110kD catalytic subunit delta) (FITC)

Sign In for Pricing
View Details
EML1 Knockout HEK293T Polyclonal Cells
ARG4531 1 Million

EML1 Knockout HEK293T Polyclonal Cells

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Karyopherin Beta (KPNb1)
MBS2075237-01 0.1 mL

FITC-Linked Polyclonal Antibody to Karyopherin Beta (KPNb1)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Karyopherin Beta (KPNb1)
MBS2075237-02 0.2 mL

FITC-Linked Polyclonal Antibody to Karyopherin Beta (KPNb1)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Karyopherin Beta (KPNb1)
MBS2075237-03 0.5 mL

FITC-Linked Polyclonal Antibody to Karyopherin Beta (KPNb1)

Sign In for Pricing
View Details