Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZFPL1 Rabbit Polyclonal Antibody (HRP)

ZFPL1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MCG4, D11S750

UniProt

O95159

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZFPL1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LLQRAGLLLLLGLLGFLALLALMSRLGRAAADSDPNLDPLMNPHIRVGPS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006773

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSPA2 (Heat Shock 70kD Protein 2, HSP70-2, HSP70-3) (MaxLight 550)
MBS6217418-01 0.1 mL

HSPA2 (Heat Shock 70kD Protein 2, HSP70-2, HSP70-3) (MaxLight 550)

Sign In for Pricing
View Details
HSPA2 (Heat Shock 70kD Protein 2, HSP70-2, HSP70-3) (MaxLight 550)
MBS6217418-02 5x 0.1 mL

HSPA2 (Heat Shock 70kD Protein 2, HSP70-2, HSP70-3) (MaxLight 550)

Sign In for Pricing
View Details
CD107a (LAMP-1, Lysosome-associated membrane protein-1) (Azide Free) (MaxLight 650) discontinued
L9190-10A-ML650 100 µL

CD107a (LAMP-1, Lysosome-associated membrane protein-1) (Azide Free) (MaxLight 650) discontinued

Sign In for Pricing
View Details
RIMKLA antibody
70R-51223 100 µL

RIMKLA antibody

Sign In for Pricing
View Details
TP53TG5 Rabbit Polyclonal Antibody
orb3070693-01 30 µL

TP53TG5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TP53TG5 Rabbit Polyclonal Antibody
orb3070693-02 50 µL

TP53TG5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details