Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM25 Rabbit Polyclonal Antibody (HRP)

TRIM25 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

EFP, Z147, RNF147, ZNF147

UniProt

Q14258

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TRIM25

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LLDASETTSTRKIKEEEKRVNSKFDTIYQILLKKKSEIQTLKEEIEQSLT

Field of Research

Infectious Disease & Virology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

71kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_005073

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPC24 Antibody
orb851602 2 mg

SPC24 Antibody

Sign In for Pricing
View Details
Zebrafish SUB1a/b Rabbit Polyclonal Antibody (Fluoro488)
orb3090487 100 µg

Zebrafish SUB1a/b Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
IL-18RAP/IL-18 R beta, His, Human
Z05456-500 500 µg

IL-18RAP/IL-18 R beta, His, Human

Sign In for Pricing
View Details
Mouse Sbds qPCR Primer Pair
QM32562S 200 Tests

Mouse Sbds qPCR Primer Pair

Sign In for Pricing
View Details
Chicken SUN domain-containing protein 2 (UNC84B) ELISA Kit
MBS2607047-01 48 Well

Chicken SUN domain-containing protein 2 (UNC84B) ELISA Kit

Sign In for Pricing
View Details
Chicken SUN domain-containing protein 2 (UNC84B) ELISA Kit
MBS2607047-02 96 Well

Chicken SUN domain-containing protein 2 (UNC84B) ELISA Kit

Sign In for Pricing
View Details