Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Peptide deformylase, S. aureus (His, SUMO)

Peptide deformylase, a crucial enzyme in protein biosynthesis, catalyzes the removal of the formyl group from the N-terminal methionine of newly synthesized proteins. Displaying broad specificity at positions beyond the N-terminal L-methionine, the enzyme ensures proper maturation and functionality of proteins, emphasizing its essential contribution to the intricate process of protein synthesis and modification. Peptide deformylase Protein, S. aureus (His, SUMO) is the recombinant staphylococcus aureus-derived Peptide deformylase protein, expressed by E. coli, with SUMO and N-6*His labeled tag.

Product Specifications

Product Name Alternative

Peptide deformylase Protein, S. aureus (His, SUMO), Staphylococcus aureus, E. coli

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/peptide-deformylase-protein-s-aureus-his-sumo.html

Smiles

MLTMKDIIRDGHPTLRQKAAELELPLTKEEKETLIAMREFLVNSQDEEIAKRYGLRSGVGLAAPQINISKRMIAVLIPDDGSGKSYDYMLVNPKIVSHSVQEAYLPTGEGCLSVDDNVAGLVHRHNRITIKAKDIEGNDIQLRLKGYPAIVFQHEIDHLNGVMFYDHIDKNHPLQPHTDAVEV

Molecular Formula

/ (Gene_ID) P68826 (M1-V183) (Accession)

Molecular Weight

Approximately 36.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXP3 (3G3), CF647 conjugate, 0.1mg/mL
BNC470645-500 1x 500 µL

FOXP3 (3G3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF405S conjugate, 0.1mg/mL
BNC041073-500 1x 500 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF594 conjugate, 0.1mg/mL
BNC940160-500 1x 500 µL

CD20 (B9E9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fascin-1 (FSCN1/416), CF740 conjugate, 0.1mg/mL
BNC740416-500 1x 500 µL

Fascin-1 (FSCN1/416), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Pan (MHC II) (HLA-Pan/2967R), CF405S conjugate, 0.1mg/mL
BNC042967-500 1x 500 µL

HLA-Pan (MHC II) (HLA-Pan/2967R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) (KRTL/1577R), CF594 conjugate, 0.1mg/mL
BNC941577-500 1x 500 µL

Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) (KRTL/1577R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details