Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RASSF7 Rabbit Polyclonal Antibody (HRP)

RASSF7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HRC1, FAP88, HRAS1, CFAP88, C11orf13

UniProt

Q02833

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RASSF7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DISIPDYCSLGDGEEEEITINAWFGPQGTISPLHQDPQQNFLVQVMGRKY

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_003466

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM71A AAV Vector (Human) (CMV)
20091101 1 µg

FAM71A AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
FGF2 Polyclonal Antibody, FITC Conjugated
bs-0217R-FITC-01 20 µL

FGF2 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
FGF2 Polyclonal Antibody, FITC Conjugated
bs-0217R-FITC-02 100 µL

FGF2 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
C19orf6 3'UTR Lenti-reporter-Luc Vector
14083081 1.0 µg

C19orf6 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Guinea pig Interleukin 1 Beta (IL1b) ELISA Kit
MBS4500270-01 48 Tests

Guinea pig Interleukin 1 Beta (IL1b) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Interleukin 1 Beta (IL1b) ELISA Kit
MBS4500270-02 96 Tests

Guinea pig Interleukin 1 Beta (IL1b) ELISA Kit

Sign In for Pricing
View Details