Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CALR Rabbit Polyclonal Antibody (HRP)

CALR Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RO, CRT, SSA, cC1qR, HEL-S-99n

UniProt

P27797

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CALR

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVT

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_004334

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Atf5 shRNA (UAS) - Lentiviral mouse Atf5 shRNA (UAS, GFP) plasmid
GTR15196966 1 Vial

Lentiviral mouse Atf5 shRNA (UAS) - Lentiviral mouse Atf5 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
ALDH1L2 Protein Vector (Rat) (pPM-C-HA)
PV253156 500 ng

ALDH1L2 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
OR11H2 Protein Vector (Human) (pPB-C-His)
PV106026 500 ng

OR11H2 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Human Prostatic Acid Phosphatase (ACP3/PAP) ELISA Kit
orb1947359-01 48 Tests

Human Prostatic Acid Phosphatase (ACP3/PAP) ELISA Kit

Sign In for Pricing
View Details
Human Prostatic Acid Phosphatase (ACP3/PAP) ELISA Kit
orb1947359-02 96 Tests

Human Prostatic Acid Phosphatase (ACP3/PAP) ELISA Kit

Sign In for Pricing
View Details
PHRF1 ORF Vector (Human) (pORF)
ORF027737 1.0 µg DNA

PHRF1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details