Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Runx1t1 Rabbit Polyclonal Antibody (Biotin)

Runx1t1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ET, ETO, MTG8, Cbfa2t1, Cbfa2t1h

UniProt

Q8C066

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PDSPVDVKTQSRLTPPAMPPPPTTQGAPRTSSFTPTTLTNGTSHSPTALN

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001104496

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAPK15 (N-term) Rabbit Polyclonal Antibody
AP14193PU-N 400 µL

MAPK15 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human FOXB2 activation kit by CRISPRa
GA118547 1 Kit

Human FOXB2 activation kit by CRISPRa

Sign In for Pricing
View Details
Human IgD (Immunoglobulin Delta Heavy Chain) (B-Cell Marker) (IgD26), CF640R conjugate, 0.1mg/mL
BNC402097-500 1x 500 µL

Human IgD (Immunoglobulin Delta Heavy Chain) (B-Cell Marker) (IgD26), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse IL-6 (Interleukin 6) CLIA Kit
E-CL-M0042-01 24 Tests

Mouse IL-6 (Interleukin 6) CLIA Kit

Sign In for Pricing
View Details
Mouse IL-6 (Interleukin 6) CLIA Kit
E-CL-M0042-02 48 Tests

Mouse IL-6 (Interleukin 6) CLIA Kit

Sign In for Pricing
View Details
Mouse IL-6 (Interleukin 6) CLIA Kit
E-CL-M0042-03 96 Tests

Mouse IL-6 (Interleukin 6) CLIA Kit

Sign In for Pricing
View Details