Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Runx1t1 Rabbit Polyclonal Antibody (HRP)

Runx1t1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ET, ETO, MTG8, Cbfa2t1, Cbfa2t1h

UniProt

Q8C066

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PDSPVDVKTQSRLTPPAMPPPPTTQGAPRTSSFTPTTLTNGTSHSPTALN

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001104496

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Donkey Polyclonal Donkey anti-Sheep IgG (H+L) Secondary Antibody [Biotin] (Pre-adsorbed)
NBP1-75442 1 mg

Donkey Polyclonal Donkey anti-Sheep IgG (H+L) Secondary Antibody [Biotin] (Pre-adsorbed)

Sign In for Pricing
View Details
EBAG9 Polyclonal Antibody
RD82417A-01 60μL

EBAG9 Polyclonal Antibody

Sign In for Pricing
View Details
EBAG9 Polyclonal Antibody
RD82417A-02 120μL

EBAG9 Polyclonal Antibody

Sign In for Pricing
View Details
EBAG9 Polyclonal Antibody
RD82417A-03 200μL

EBAG9 Polyclonal Antibody

Sign In for Pricing
View Details
TXNRD1 Antibody - middle region
ARP97491_P050-25UL 25 µL

TXNRD1 Antibody - middle region

Sign In for Pricing
View Details
TLK1 (Phospho Ser764) rabbit pAb
MBS8600200-01 0.1 mL

TLK1 (Phospho Ser764) rabbit pAb

Sign In for Pricing
View Details