Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASH2L Rabbit Polyclonal Antibody (HRP)

ASH2L Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ASH2, Bre2, ASH2L1, ASH2L2

UniProt

Q9UBL3

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ASH2L

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GPGQEAGAGPGPGAVANATGAEEGEMKPVAAGAAAPPGEGISAAPTVEPS

Field of Research

Epigenetics & Chromatin

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

69 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken Tumor necrosis factor β (TNF-β) ELISA Kit
YP-W60162-01 48 Tests

Chicken Tumor necrosis factor β (TNF-β) ELISA Kit

Sign In for Pricing
View Details
Chicken Tumor necrosis factor β (TNF-β) ELISA Kit
YP-W60162-02 96 Tests

Chicken Tumor necrosis factor β (TNF-β) ELISA Kit

Sign In for Pricing
View Details
RBX1 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV626885 1.0 µg DNA

RBX1 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Recombinant RRV p130/Structural polyprotein Protein, N-His
YVV38101 100 μg

Recombinant RRV p130/Structural polyprotein Protein, N-His

Sign In for Pricing
View Details
Recombinant Uncharacterized protein Rv1824/MT1872 (Rv1824, MT1872)
orb2933164-01 20 µg

Recombinant Uncharacterized protein Rv1824/MT1872 (Rv1824, MT1872)

Sign In for Pricing
View Details
Recombinant Uncharacterized protein Rv1824/MT1872 (Rv1824, MT1872)
orb2933164-02 100 µg

Recombinant Uncharacterized protein Rv1824/MT1872 (Rv1824, MT1872)

Sign In for Pricing
View Details