Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMGB2 Rabbit Polyclonal Antibody (Biotin)

HMGB2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HMG2

UniProt

P26583

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human HMGB2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYE

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_002120

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat AMP deaminase 3 (AMPD3) ELISA Kit
GTR10353344 96 Well

Goat AMP deaminase 3 (AMPD3) ELISA Kit

Sign In for Pricing
View Details
Recombinant Clostridium perfringens Phosphoenolpyruvate carboxylase (ppcA), partial
MBS1477619 Inquire

Recombinant Clostridium perfringens Phosphoenolpyruvate carboxylase (ppcA), partial

Sign In for Pricing
View Details
JTV1 (Aminoacyl tRNA Synthase Complex-interacting Multifunctional Protein 2, Multisynthase Complex Auxiliary Component p38, Protein JTV-1, AIMP2, JTV1, PRO0992) discontinued
360633-01 50 µL

JTV1 (Aminoacyl tRNA Synthase Complex-interacting Multifunctional Protein 2, Multisynthase Complex Auxiliary Component p38, Protein JTV-1, AIMP2, JTV1, PRO0992) discontinued

Sign In for Pricing
View Details
JTV1 (Aminoacyl tRNA Synthase Complex-interacting Multifunctional Protein 2, Multisynthase Complex Auxiliary Component p38, Protein JTV-1, AIMP2, JTV1, PRO0992) discontinued
360633-02 100 µL

JTV1 (Aminoacyl tRNA Synthase Complex-interacting Multifunctional Protein 2, Multisynthase Complex Auxiliary Component p38, Protein JTV-1, AIMP2, JTV1, PRO0992) discontinued

Sign In for Pricing
View Details
Rat Cdkl1 ELISA Kit
ELI-34186r 96 Tests

Rat Cdkl1 ELISA Kit

Sign In for Pricing
View Details
Fludarabine Phosphate
orb1300713-01 5 mg

Fludarabine Phosphate

Sign In for Pricing
View Details