Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NRL Rabbit Polyclonal Antibody (Biotin)

NRL Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RP27, D14S46E, NRL-MAF

UniProt

P54845

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human NRL

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LEAERARLAAQLDALRAEVARLARERDLYKARCDRLTSSGPGSGDPSHLF

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

XP_005267767

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vxn Mouse shRNA Lentiviral Particle (Locus ID 76982)
TL515211V 500 µL Each

Vxn Mouse shRNA Lentiviral Particle (Locus ID 76982)

Sign In for Pricing
View Details
Anti-TRIOBP Antibody Picoband® APC Conjugated
A05614-1-APC 100 µg/Vial

Anti-TRIOBP Antibody Picoband® APC Conjugated

Sign In for Pricing
View Details
Human KIF5B (Kinesin Family Member 5B) ELISA Kit
MBS8820633-01 48 Well

Human KIF5B (Kinesin Family Member 5B) ELISA Kit

Sign In for Pricing
View Details
Human KIF5B (Kinesin Family Member 5B) ELISA Kit
MBS8820633-02 96 Well

Human KIF5B (Kinesin Family Member 5B) ELISA Kit

Sign In for Pricing
View Details
Human KIF5B (Kinesin Family Member 5B) ELISA Kit
MBS8820633-03 5x 96 Well

Human KIF5B (Kinesin Family Member 5B) ELISA Kit

Sign In for Pricing
View Details
Human KIF5B (Kinesin Family Member 5B) ELISA Kit
MBS8820633-04 10x 96 Well

Human KIF5B (Kinesin Family Member 5B) ELISA Kit

Sign In for Pricing
View Details