Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFDP3 Rabbit Polyclonal Antibody (FITC)

TFDP3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

DP4, CT30, HCA661

UniProt

Q5H9I0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TFDP3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ASDLTNIAIGMLATSSGGSQYSGSRVETPAVEEEEEEDNNDDDLSENDED

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_057605

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Defensin Beta 2 (DEFb2) ELISA Kit
orb1666788-01 48 Tests

Human Defensin Beta 2 (DEFb2) ELISA Kit

Sign In for Pricing
View Details
Human Defensin Beta 2 (DEFb2) ELISA Kit
orb1666788-02 96 Tests

Human Defensin Beta 2 (DEFb2) ELISA Kit

Sign In for Pricing
View Details
FAM44B, CT (BOD1, FAM44B, Biorientation of chromosomes in cell division protein 1, Biorientation defective protein 1, Protein FAM44B) (MaxLight 405)
MBS6297861-01 0.1 mL

FAM44B, CT (BOD1, FAM44B, Biorientation of chromosomes in cell division protein 1, Biorientation defective protein 1, Protein FAM44B) (MaxLight 405)

Sign In for Pricing
View Details
FAM44B, CT (BOD1, FAM44B, Biorientation of chromosomes in cell division protein 1, Biorientation defective protein 1, Protein FAM44B) (MaxLight 405)
MBS6297861-02 5x 0.1 mL

FAM44B, CT (BOD1, FAM44B, Biorientation of chromosomes in cell division protein 1, Biorientation defective protein 1, Protein FAM44B) (MaxLight 405)

Sign In for Pricing
View Details
TASK-1 discontinued
347877-01 100 µL

TASK-1 discontinued

Sign In for Pricing
View Details
TASK-1 discontinued
347877-02 200 µL

TASK-1 discontinued

Sign In for Pricing
View Details