Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

A2BP1 Rabbit Polyclonal Antibody (FITC)

A2BP1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

2BP1, FOX1, A2BP1, FOX-1, HRNBP1

UniProt

Q9NWB1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human A2BP1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TAAAYSDRNQFVFVAADEISCNTSAVTDEFMLPTPTTTHLLQPPPTALVP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_665900

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Anti-RVFV Gn Monoclonal Antibody, clone 241
CABT-CS643 1mL

Mouse Anti-RVFV Gn Monoclonal Antibody, clone 241

Sign In for Pricing
View Details
Lentiviral human USP19 sgRNA gene knockout kit - Lentiviral human USP19 sgRNA gene knockout kit (plasmid)
GTR15355549 1 Vial

Lentiviral human USP19 sgRNA gene knockout kit - Lentiviral human USP19 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Active Receptor Tyrosine Protein Kinase erbB-2 (ErbB2)
TRV-0005287-01 10 µg

Active Receptor Tyrosine Protein Kinase erbB-2 (ErbB2)

Sign In for Pricing
View Details
Active Receptor Tyrosine Protein Kinase erbB-2 (ErbB2)
TRV-0005287-02 50 µg

Active Receptor Tyrosine Protein Kinase erbB-2 (ErbB2)

Sign In for Pricing
View Details
Active Receptor Tyrosine Protein Kinase erbB-2 (ErbB2)
TRV-0005287-03 100 µg

Active Receptor Tyrosine Protein Kinase erbB-2 (ErbB2)

Sign In for Pricing
View Details
Active Receptor Tyrosine Protein Kinase erbB-2 (ErbB2)
TRV-0005287-04 200 µg

Active Receptor Tyrosine Protein Kinase erbB-2 (ErbB2)

Sign In for Pricing
View Details