Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Jmjd8 Rabbit Polyclonal Antibody (HRP)

Jmjd8 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

2610003J06Rik

UniProt

Q3TA59

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PAYSFGIAGAGSGVPFHWHGPGFSEVIYGRKRWFLYPPEKTPEFHPNKTT

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_082377

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Beta-Catenin/CTNNB1 Protein (His & GST Tag)
PKSM040590 20 µg

Recombinant Mouse Beta-Catenin/CTNNB1 Protein (His & GST Tag)

Sign In for Pricing
View Details
CD32A (FCGR2A) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI13G9]
TA500646AM 100 µL

CD32A (FCGR2A) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI13G9]

Sign In for Pricing
View Details
CD54 (W-CAM-1; same as Wehi-CAM-1 or 1H4), Biotin conjugate, 0.1mg/mL
BNCB0988-500 1x 500 µL

CD54 (W-CAM-1; same as Wehi-CAM-1 or 1H4), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TFIP8 Antibody
8C10226-AAT 50 µg

TFIP8 Antibody

Sign In for Pricing
View Details
TNF alpha (TNF) (NM_000594) Human Over-expression Lysate
LC424626 20 µg

TNF alpha (TNF) (NM_000594) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS801885 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details