Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Impa2 Rabbit Polyclonal Antibody (HRP)

Impa2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

IMP 2, AI326924, AW259601, IMPase 2, 2210415D20Rik

UniProt

Q91UZ5

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Impa2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GAFCNGQRLQVSRETDLAKALVLTEIGPKRDPDTLKVFLSNMERLLHAKA

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_444491

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Ferritin Light Chain Antibody (FTL/1386) [DyLight 755]
NBP2-54574IR 100 µL

Mouse Monoclonal Ferritin Light Chain Antibody (FTL/1386) [DyLight 755]

Sign In for Pricing
View Details
Pro-Insulin Like Growth Factor-2 Human Recombinant (pro-IGF2 Human)
PT_72607-01 2 µg

Pro-Insulin Like Growth Factor-2 Human Recombinant (pro-IGF2 Human)

Sign In for Pricing
View Details
Pro-Insulin Like Growth Factor-2 Human Recombinant (pro-IGF2 Human)
PT_72607-02 10 µg

Pro-Insulin Like Growth Factor-2 Human Recombinant (pro-IGF2 Human)

Sign In for Pricing
View Details
Pro-Insulin Like Growth Factor-2 Human Recombinant (pro-IGF2 Human)
PT_72607-03 1 mg

Pro-Insulin Like Growth Factor-2 Human Recombinant (pro-IGF2 Human)

Sign In for Pricing
View Details
MR1 Antibody, Biotin conjugated
A65314-50UG 50 µg

MR1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Compound NP-012949
MBS5794868 Inquire

Compound NP-012949

Sign In for Pricing
View Details