TM4SF2/TSPAN7, Cynomolgus (HEK293, His)
TM4SF2/TSPAN7 protein is an important member of the tetraspanin family and plays an important role in signal transduction, cell adhesion, and membrane organization. Its research enhances understanding of cell membrane dynamics and provides potential applications in cell biology and cancer research. TM4SF2/TSPAN7 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived TM4SF2/TSPAN7 protein, expressed by HEK293 , with N-His labeled tag.
Product Specifications
Product Name Alternative
TM4SF2/TSPAN7 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/tm4sf2-tspan7-protein-cynomolgus-hek293-his.html
Purity
96.50
Smiles
RHEIKDTFLRTYTDAMQNYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLDHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMETNM
Molecular Formula
102127880 (Gene_ID) Q4R5A3 (R113-M213) (Accession)
Molecular Weight
Approximately 17-28 kDa due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Recombinant Human Glutaryl-CoA Dehydrogenase Mitochondrial/GCDH Protein (N-6His)
Recombinant Human Glutaryl-CoA Dehydrogenase Mitochondrial/GCDH Protein (N-6His)
Recombinant Human Glutaryl-CoA Dehydrogenase Mitochondrial/GCDH Protein (N-6His)
Recombinant Human Glutaryl-CoA Dehydrogenase Mitochondrial/GCDH Protein (N-6His)
Recombinant Human Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 3 (LINGO3), partial
