Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Acin1 Rabbit Polyclonal Antibody (FITC)

Acin1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Ac, Acn, Acinus, C79325, acinusL, acinusS, mKIAA0670, 2610036I19Rik, 2610510L13Rik

UniProt

Q9JIX8

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: HSPRKSSSFSEEKGESDDEKPRKGERRSSRVRQAKSKLPEYSQTAEEEED

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001078942

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Claudin 5 (CLDN5) ELISA Kit
RDR-CLDN5-Hu-01 96 Tests

Human Claudin 5 (CLDN5) ELISA Kit

Sign In for Pricing
View Details
Human Claudin 5 (CLDN5) ELISA Kit
RDR-CLDN5-Hu-02 48 Tests

Human Claudin 5 (CLDN5) ELISA Kit

Sign In for Pricing
View Details
C14orf166B (LRRC74A) (NM_001081002) Human Over-expression Lysate
LC421148 20 µg

C14orf166B (LRRC74A) (NM_001081002) Human Over-expression Lysate

Sign In for Pricing
View Details
Vmn1r86 Mouse Gene Knockout Kit (CRISPR)
KN519103 1 Kit

Vmn1r86 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TSPAN12 (NM_012338) Human Over-expression Lysate
LC402200 20 µg

TSPAN12 (NM_012338) Human Over-expression Lysate

Sign In for Pricing
View Details
TRIM29 (TRIM29/1041), CF640R conjugate, 0.1mg/mL
BNC401041-500 1x 500 µL

TRIM29 (TRIM29/1041), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details