Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Acin1 Rabbit Polyclonal Antibody (HRP)

Acin1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Ac, Acn, Acinus, C79325, acinusL, acinusS, mKIAA0670, 2610036I19Rik, 2610510L13Rik

UniProt

Q9JIX8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HSPRKSSSFSEEKGESDDEKPRKGERRSSRVRQAKSKLPEYSQTAEEEED

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001078942

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUP85 antibody
70R-19007 50 μL

NUP85 antibody

Sign In for Pricing
View Details
Human Prostaglandin E Synthase 2 (mPGES-2, PTGES2) AssayLite™ Antibody (APC Conjugate)
31378-05161 5x 30 µg

Human Prostaglandin E Synthase 2 (mPGES-2, PTGES2) AssayLite™ Antibody (APC Conjugate)

Sign In for Pricing
View Details
ABP1 Protein Vector (Human) (pPB-His-GST)
PV319015 500 ng

ABP1 Protein Vector (Human) (pPB-His-GST)

Sign In for Pricing
View Details
PGAM2, NT (PGAM2, PGAMM, Phosphoglycerate mutase 2, BPG-dependent PGAM 2, Muscle-specific phosphoglycerate mutase, Phosphoglycerate mutase isozyme M) (AP) discontinued
039910-AP 200 µL

PGAM2, NT (PGAM2, PGAMM, Phosphoglycerate mutase 2, BPG-dependent PGAM 2, Muscle-specific phosphoglycerate mutase, Phosphoglycerate mutase isozyme M) (AP) discontinued

Sign In for Pricing
View Details
SB 649915
MBS5778355 Inquire

SB 649915

Sign In for Pricing
View Details
Rabbit Polyclonal BBX Antibody [Alexa Fluor 532]
NBP1-71906AF532 0.1 mL

Rabbit Polyclonal BBX Antibody [Alexa Fluor 532]

Sign In for Pricing
View Details