Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Acin1 Rabbit Polyclonal Antibody (HRP)

Acin1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Ac, Acn, Acinus, C79325, acinusL, acinusS, mKIAA0670, 2610036I19Rik, 2610510L13Rik

UniProt

Q52KR6

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Acin1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RSEREWDRDKVREGPRSRSRSRDRRRKERAKSKEKKSEKKEKAQEEPPAK

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001229535

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VILIP1 (VSNL1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5B4]
TA802022AM 100 µL

VILIP1 (VSNL1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5B4]

Sign In for Pricing
View Details
Lomefloxacin Hydrochloride
TRC-L469415-50MG 50 mg

Lomefloxacin Hydrochloride

Sign In for Pricing
View Details
AMPD1 Polyclonal Antibody
E-AB-12967-01 20 µL

AMPD1 Polyclonal Antibody

Sign In for Pricing
View Details
AMPD1 Polyclonal Antibody
E-AB-12967-02 60 µL

AMPD1 Polyclonal Antibody

Sign In for Pricing
View Details
AMPD1 Polyclonal Antibody
E-AB-12967-03 120 µL

AMPD1 Polyclonal Antibody

Sign In for Pricing
View Details
AMPD1 Polyclonal Antibody
E-AB-12967-04 200 µL

AMPD1 Polyclonal Antibody

Sign In for Pricing
View Details