Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASF1A Rabbit Polyclonal Antibody (HRP)

ASF1A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CIA, CGI-98, HSPC146

UniProt

Q9Y294

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ASF1A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAES

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Goat, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_054753

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal TTF-1 / NKX2-1 Antibody (NX2.1/1855R) [Alexa Fluor 350]

NBP3-08726AF350 100 µL

Rabbit Monoclonal TTF-1 / NKX2-1 Antibody (NX2.1/1855R) [Alexa Fluor 350]

Sign In for Pricing

Rat Zfp113 Pre-designed siRNA Set A

SI216268A 1 Each

Rat Zfp113 Pre-designed siRNA Set A

Sign In for Pricing

Fiacitabine 1mg

A11422-1 1 mg

Fiacitabine 1mg

Sign In for Pricing

Siglec 1 (Sialic Acid Binding Ig-like Lectin 1, CD169, CD169 Antigen, dJ1009E24.1, DKFZp667F058, FLJ00051, FLJ00055, FLJ00073, FLJ00411, FLJ32150, Sialic Acid-binding Ig-like Lectin 1, Sialic Acid-binding Ig-like Lectin-1, Sialoadhesin, Sialoadhesin Precursor, Siglec 1, SN) (MaxLight 550) discontinued

S1013-57E2-ML550 100 µL

Siglec 1 (Sialic Acid Binding Ig-like Lectin 1, CD169, CD169 Antigen, dJ1009E24.1, DKFZp667F058, FLJ00051, FLJ00055, FLJ00073, FLJ00411, FLJ32150, Sialic Acid-binding Ig-like Lectin 1, Sialic Acid-binding Ig-like Lectin-1, Sialoadhesin, Sialoadhesin Precursor, Siglec 1, SN) (MaxLight 550) discontinued

Sign In for Pricing

SH2D3C (SH2 Domain-Containing Protein 3C, Novel SH2-Containing Protein 3, NSP3, UNQ272/PRO309/PRO34088) (APC)

133294-APC 100 µL

SH2D3C (SH2 Domain-Containing Protein 3C, Novel SH2-Containing Protein 3, NSP3, UNQ272/PRO309/PRO34088) (APC)

Sign In for Pricing

Lentiviral human AMBN shRNA (UAS) - Lentiviral human AMBN shRNA (UAS) (100)

GTR15098130 1 Vial

Lentiviral human AMBN shRNA (UAS) - Lentiviral human AMBN shRNA (UAS) (100)

Sign In for Pricing