Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASF1A Rabbit Polyclonal Antibody (HRP)

ASF1A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CIA, CGI-98, HSPC146

UniProt

Q9Y294

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ASF1A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAES

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Goat, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_054753

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Fibroblast Growth Factor 3 (FGF3) ELISA Kit
EIA07903m 1 Kit

Mouse Fibroblast Growth Factor 3 (FGF3) ELISA Kit

Sign In for Pricing
View Details
Recombinant Late Cornified Envelope Like Proline Rich Protein 1 (LELP1)
TRV-0015393-01 10 µg

Recombinant Late Cornified Envelope Like Proline Rich Protein 1 (LELP1)

Sign In for Pricing
View Details
Recombinant Late Cornified Envelope Like Proline Rich Protein 1 (LELP1)
TRV-0015393-02 50 µg

Recombinant Late Cornified Envelope Like Proline Rich Protein 1 (LELP1)

Sign In for Pricing
View Details
Recombinant Late Cornified Envelope Like Proline Rich Protein 1 (LELP1)
TRV-0015393-03 100 µg

Recombinant Late Cornified Envelope Like Proline Rich Protein 1 (LELP1)

Sign In for Pricing
View Details
Recombinant Late Cornified Envelope Like Proline Rich Protein 1 (LELP1)
TRV-0015393-04 200 µg

Recombinant Late Cornified Envelope Like Proline Rich Protein 1 (LELP1)

Sign In for Pricing
View Details
Recombinant Late Cornified Envelope Like Proline Rich Protein 1 (LELP1)
TRV-0015393-05 500 µg

Recombinant Late Cornified Envelope Like Proline Rich Protein 1 (LELP1)

Sign In for Pricing
View Details