Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDCA5 Rabbit Polyclonal Antibody (FITC)

CDCA5 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SORORIN

UniProt

Q96FF9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CDCA5

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RRSYSRLETLGSASTSTPGRRSCFGFEGLLGAEDLSGVSPVVCSKLTEVP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_542399

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glucokinase regulatory protein Rabbit Polyclonal Antibody (Biotin)
orb459038 100 µL

Glucokinase regulatory protein Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
ZAP70 (70kD zeta-chain Associated Protein, ZAP-70, Tyrosine-protein Kinase ZAP-70, Syk-related Tyrosine Kinase, SRK, STCD, STD, TZK) (MaxLight 490)
MBS6398893-01 0.1 mL

ZAP70 (70kD zeta-chain Associated Protein, ZAP-70, Tyrosine-protein Kinase ZAP-70, Syk-related Tyrosine Kinase, SRK, STCD, STD, TZK) (MaxLight 490)

Sign In for Pricing
View Details
ZAP70 (70kD zeta-chain Associated Protein, ZAP-70, Tyrosine-protein Kinase ZAP-70, Syk-related Tyrosine Kinase, SRK, STCD, STD, TZK) (MaxLight 490)
MBS6398893-02 5x 0.1 mL

ZAP70 (70kD zeta-chain Associated Protein, ZAP-70, Tyrosine-protein Kinase ZAP-70, Syk-related Tyrosine Kinase, SRK, STCD, STD, TZK) (MaxLight 490)

Sign In for Pricing
View Details
Lyst 3'UTR Luciferase Stable Cell Line
TU212723 1.0 mL

Lyst 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
CAV1 Antibody (HRP)
orb685678-01 50 μL

CAV1 Antibody (HRP)

Sign In for Pricing
View Details
CAV1 Antibody (HRP)
orb685678-02 100 µL

CAV1 Antibody (HRP)

Sign In for Pricing
View Details