Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

H2AFX Rabbit Polyclonal Antibody (HRP)

H2AFX Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

H2A.X, H2A/X, H2AFX

UniProt

P16104

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human H2AFX

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVY

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

16kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002096

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GADD153 (DNA Damage-inducible Transcript 3 Protein, DDIT-3, C/EBP-homologous Protein, CHOP, C/EBP-homologous Protein 10, CHOP-10, Growth Arrest and DNA Damage-inducible Protein GADD153, DDIT3, CHOP, CHOP10) (PE)
MBS6157916-01 0.1 mL

GADD153 (DNA Damage-inducible Transcript 3 Protein, DDIT-3, C/EBP-homologous Protein, CHOP, C/EBP-homologous Protein 10, CHOP-10, Growth Arrest and DNA Damage-inducible Protein GADD153, DDIT3, CHOP, CHOP10) (PE)

Sign In for Pricing
View Details
GADD153 (DNA Damage-inducible Transcript 3 Protein, DDIT-3, C/EBP-homologous Protein, CHOP, C/EBP-homologous Protein 10, CHOP-10, Growth Arrest and DNA Damage-inducible Protein GADD153, DDIT3, CHOP, CHOP10) (PE)
MBS6157916-02 5x 0.1 mL

GADD153 (DNA Damage-inducible Transcript 3 Protein, DDIT-3, C/EBP-homologous Protein, CHOP, C/EBP-homologous Protein 10, CHOP-10, Growth Arrest and DNA Damage-inducible Protein GADD153, DDIT3, CHOP, CHOP10) (PE)

Sign In for Pricing
View Details
NUDC CRISPRa sgRNA lentivector (set of three targets)(Mouse)
32269124 3x 1.0µg DNA

NUDC CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Villin/VIL1 Rabbit Polyclonal Antibody (PE)
orb2621499 100 µg

Villin/VIL1 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
TAF1 48 (TAF1A) Rabbit Polyclonal Antibody
TA314847 100 µL

TAF1 48 (TAF1A) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Clostridium Botulinum engB Protein (aa 1-198) (strain Eklund 17B / Type B)
VAng-Lsx8179-500gEcoli 500 µg (E. coli)

Recombinant Clostridium Botulinum engB Protein (aa 1-198) (strain Eklund 17B / Type B)

Sign In for Pricing
View Details