Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

H2AFY Rabbit Polyclonal Antibody (Biotin)

H2AFY Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

H2A.y, H2A/y, H2AFY, mH2A1, H2AF12M, MACROH2A1.1, macroH2A1.2

UniProt

O75367

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human H2AFY

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MSSRGGKKKSTKTSRSAKAGVIFPVGRMLRYIKKGHPKYRIGVGAPVYMA

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_613075

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgG (H&L) Antibody F (ab') 2 - Rhodamine Conjugated
OARA03955-500UL 500 µL

Human IgG (H&L) Antibody F (ab') 2 - Rhodamine Conjugated

Sign In for Pricing
View Details
Recombinant Mycobacterium Tuberculosis Rv1989c Protein (aa 1-186)
VAng-Yyj0689-inquire Inquire

Recombinant Mycobacterium Tuberculosis Rv1989c Protein (aa 1-186)

Sign In for Pricing
View Details
Rabbit anti-human Intestine-specific homeobox polyclonal Antibody(ISX)
MBS1499385-01 0.05 mg

Rabbit anti-human Intestine-specific homeobox polyclonal Antibody(ISX)

Sign In for Pricing
View Details
Rabbit anti-human Intestine-specific homeobox polyclonal Antibody(ISX)
MBS1499385-02 0.1 mg

Rabbit anti-human Intestine-specific homeobox polyclonal Antibody(ISX)

Sign In for Pricing
View Details
Rabbit anti-human Intestine-specific homeobox polyclonal Antibody(ISX)
MBS1499385-03 5x 0.1 mg

Rabbit anti-human Intestine-specific homeobox polyclonal Antibody(ISX)

Sign In for Pricing
View Details
Monoclonal PLA2G1B Antibody (monoclonal) (M01), Clone: 1B3
AMR09318G 0.1mg

Monoclonal PLA2G1B Antibody (monoclonal) (M01), Clone: 1B3

Sign In for Pricing
View Details