Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

H2AFY Rabbit Polyclonal Antibody (HRP)

H2AFY Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

H2A.y, H2A/y, H2AFY, mH2A1, H2AF12M, MACROH2A1.1, macroH2A1.2

UniProt

O75367

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human H2AFY

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PVSKKAGGKKGARKSKKQGEVSKAASADSTTEGTPADGFTVLSTKSLFLG

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001035248

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PGAM2 Antibody Picoband® Biotin Conjugated
A10014-2-Biotin 100 µg/Vial

Anti-PGAM2 Antibody Picoband® Biotin Conjugated

Sign In for Pricing
View Details
C21orf67 Protein Vector (Human) (pPM-C-His)
PV049892 500 ng

C21orf67 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Anti-PGLS Antibody Picoband®, iFluor647 Conjugate
A02553-2-iFluor647 100 µg

Anti-PGLS Antibody Picoband®, iFluor647 Conjugate

Sign In for Pricing
View Details
Rat Creatine kinase M-type (CKM) ELISA Kit
AE62852RA-01 48 Tests

Rat Creatine kinase M-type (CKM) ELISA Kit

Sign In for Pricing
View Details
Rat Creatine kinase M-type (CKM) ELISA Kit
AE62852RA-02 96 Tests

Rat Creatine kinase M-type (CKM) ELISA Kit

Sign In for Pricing
View Details
Mouse Zinc Finger and BTB Domain Containing 10 (ZBTB10) ELISA Kit
MBS9919546-01 48 Well

Mouse Zinc Finger and BTB Domain Containing 10 (ZBTB10) ELISA Kit

Sign In for Pricing
View Details