Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

H2AFY Rabbit Polyclonal Antibody (HRP)

H2AFY Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

H2A.y, H2A/y, H2AFY, mH2A1, H2AF12M, MACROH2A1.1, macroH2A1.2

UniProt

O75367

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human H2AFY

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HPKYRIGVGAPVYMAAVLEYLTAEILELAGNAARDNKKGRVTPRHILLAV

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001035248

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBE2B (Ubiquitin-conjugating Enzyme E2B (RAD6 Homolog), E2-17kD, HHR6B, HR6B, RAD6B, UBC2) (MaxLight 750)
MBS6241258-01 0.1 mL

UBE2B (Ubiquitin-conjugating Enzyme E2B (RAD6 Homolog), E2-17kD, HHR6B, HR6B, RAD6B, UBC2) (MaxLight 750)

Sign In for Pricing
View Details
UBE2B (Ubiquitin-conjugating Enzyme E2B (RAD6 Homolog), E2-17kD, HHR6B, HR6B, RAD6B, UBC2) (MaxLight 750)
MBS6241258-02 5x 0.1 mL

UBE2B (Ubiquitin-conjugating Enzyme E2B (RAD6 Homolog), E2-17kD, HHR6B, HR6B, RAD6B, UBC2) (MaxLight 750)

Sign In for Pricing
View Details
Anti-CD30/Tnfrsf8 Picoband® Antibody Fluoro647 Conjugated
A01225-1-Fluoro647 100 µg/Vial

Anti-CD30/Tnfrsf8 Picoband® Antibody Fluoro647 Conjugated

Sign In for Pricing
View Details
A1BG Antibody
MBS7104709-01 0.05 mg

A1BG Antibody

Sign In for Pricing
View Details
A1BG Antibody
MBS7104709-02 0.1 mg

A1BG Antibody

Sign In for Pricing
View Details
A1BG Antibody
MBS7104709-03 5x 0.1 mg

A1BG Antibody

Sign In for Pricing
View Details